DPCstruct | MC11568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 193 ± 25 aa |
| Standard deviation of domain lengths | 25.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YLN9 | 24-212 | KNAPVEIPPAIKRGPTDLLRALSETVGVDPTAPHFAFIDDPAMIPSTAAMKRNYYMAKEMGKRAARQLAEEWPTLFALDRDEPYLPA… |
| A0A6A4WZJ7 | 2-156 | VALSSTVGRDLTASHFKFHDDPYLMPRSNPDKRQFALSQEAGRNAARWIRDHKPELFSHQTAQPFSQAYAPVEVFDTDSAVSEETLL… |
| A0A085MFC1 | 223-417 | None |
| A0A3P7MVJ6 | 1-175 | None |
| A0A6P8VRN7 | 11-238 | None |
| A0A6P8H5W8 | 2-167 | None |
| A0A7R9LJR1 | 116-307 | None |
| A0A5E4Q1Z0 | 1-218 | None |
| A0A183ESX0 | 15-249 | None |
| A0A0V1G4N9 | 17-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.