DPCstruct | MC11563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 156 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4Y149 | 4-128 | ECAYKKKKFCGPVKEAYQLNNSSQHLLVGDKFKEDRERIFLANEKVLDVLKEKNKSGLIPALRSVFESETNAVFQVKVSCTGSQKTK… |
| A0A0N4Y9T5 | 4-163 | QEAIADECKLGNRKFCLLIDDAHEMNGDCLMLMEGELDGNGKKALDLANKIVGAVQKAEKQQLMPALKNAIKAQLSAFVQVKADCFT… |
| A0A0N4XI37 | 35-200 | None |
| A0A0N4XFN2 | 2-153 | None |
| A0A0N4XF99 | 213-371 | None |
| A0A158QWM3 | 163-324 | None |
| A0A0N4YJR3 | 18-184 | None |
| A0A0N4YNN8 | 185-354 | None |
| A0A0N4YC07 | 2-152 | None |
| A0A0N4YB57 | 117-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.