DPCstruct | MC11562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 91 ± 2 aa |
| Standard deviation of domain lengths | 2.15 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368FDR0 | 92-183 | LFGQMAHVAIPALKHPLARSKKVQDMFQLANVPSISEMECWGDGRKEDELRKKNSFHLTAYGVALAIDAHRRRCHEYAKAVEEAKEK… |
| A0A0N4Y9P8 | 1-92 | MAHVALPSLRNLVARSKRVGDMFQLANVASINEQECWGDERKEQELWMKNSAYLTAYRLALAIEAHALRCSALAQADEQAQVINFEH… |
| A0A0N4YRV4 | 189-276 | None |
| A0A183F2A7 | 108-205 | None |
| A0A0B1TIY8 | 1-89 | None |
| A0A0D6LZA7 | 109-200 | None |
| A0A0B1T7F5 | 1-92 | None |
| A0A0N4YYM6 | 539-628 | None |
| A0A0N4YRT6 | 65-152 | None |
| A0A183GD59 | 244-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.