DPCstruct | MC11561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IJN5 | 265-374 | TERRAIDIGTAAALPGCPLVPAVYLFLVDLEVQRVTDVFTLRDDMVNFDGQTGVQLFGTDLLLVTSLARQTVHLLRIRETSCDRGYV… |
| A0A3Q7R365 | 153-274 | CVIVGSAAYLPDEPHPPFYEVYRNSESVTPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTI… |
| A0A2G5B2N1 | 125-243 | None |
| A0A7J7QMY3 | 214-309 | None |
| A0A6A4J3C0 | 524-655 | None |
| A0A1Y1X0W6 | 117-225 | None |
| A0A2T8IM24 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.