DPCstruct | MC11560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 276 ± 47 aa |
| Standard deviation of domain lengths | 46.86 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0N9A0 | 8-225 | QFGRAMGSLTEDCMHKAGYGSWSSAPDLPKVGPKTLTDLRYGIHDAVLVGKRGYHPDAAEKAAHDAAVEAAVAGGTRGAAAVAESDC… |
| A0A3M2JJ97 | 1-293 | MTRARAVGATTFVLAASLLVGCAPGAASGSATPDPERDGPLTEYLAQVFGDSTDPVALADQQRAMQEAVAACMAEQGFDYVPRTPQT… |
| A0A545AIQ5 | 28-336 | None |
| A0AC36 | 116-412 | None |
| A0A6G8FIF9 | 2-294 | None |
| A0A511YYR2 | 26-391 | None |
| A0A7W8ELW2 | 2-259 | None |
| A0A161HSV9 | 59-339 | None |
| A0A646KGN3 | 111-372 | None |
| A0A5J6HL36 | 1-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.