DPCstruct | MC1156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 23.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF05078- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565CG19 | 2-126 | LVAICGFSCFILSFTDTYKGNNGTICYGFATFNGFRIIDGSATLPQELSKRYKLRFIDFAHAFMSLLVFGAVVLFHRNAVNCFFPAP… |
| A0A3B6TLL7 | 6-175 | NLAQLLPTGTLLAHQALSPSFTNHGKCDASNQWLTTVMVIILTTLCILFSFTDSVLGRDQKLYYGVATPRGFNVFNFSDEEEKLKWT… |
| A0A4Y7IGI8 | 10-150 | None |
| A0A7S0YH77 | 4-190 | None |
| A0A3S4PF44 | 203-306 | None |
| A0A1E5V9H2 | 29-179 | None |
| A0A0E0JJ21 | 39-237 | None |
| A0A6B9VBA4 | 60-216 | None |
| A0A835RXU8 | 10-143 | None |
| A0A059C9C3 | 13-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.