DPCstruct | MC11556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 113 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 87.14 |
| Assigned Pfam label(s) | CL0063- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6A9V2 | 2-106 | LETARKYLAYPISRKDVLASFAGLRPLFNPNAGGSTAAVSREHSVIPEFKNMITVTGGKWTAYRKMAEHAMSVAVDQGLIYKRPCPT… |
| A0A7H4NB12 | 31-142 | LNVYNAHFKKPLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDDNGQAPLLSVFGGKLTTYRKLAEHALEKLTPYYKGIGPA… |
| T1H9V9 | 39-149 | None |
| M6ZTM7 | 2-109 | None |
| W1NIE1 | 278-416 | None |
| A0A4U9HZU8 | 17-121 | None |
| A0A1I8IQQ7 | 228-336 | None |
| E9GAW1 | 31-166 | None |
| A0A381GC73 | 59-147 | None |
| A0A6G3VJ32 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.