DPCstruct | MC11555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 10.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 33.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H6U4X5 | 1-135 | MRWKRARRSDNVVDARGGGLRFGGKSLGLGGIALVVIVGLLMGRDPGQILTELTTQSSVDSRQAGAPPADDEHAEFVRAVLGDTEDT… |
| R5ZRL1 | 1-136 | MLWKDREGSSNVEDRRGEGGGFGGGGPRFPLPRGKMGLAVLAVVLVAGYYGIDLTPLLGLDSPMAPTQTSSSYQPSAQEQELAKFSS… |
| A0A116NHH8 | 24-178 | None |
| A0A6Z7A4W3 | 1-145 | None |
| X8FNB7 | 1-134 | None |
| A0A661FGZ9 | 1-157 | None |
| A0A539D908 | 1-124 | None |
| A0A7J6Z051 | 297-434 | None |
| A0A0K1PKV7 | 1-147 | None |
| A0A7R9BVE2 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.