DPCstruct | MC11554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4G971 | 1-94 | MLLSVFKTCVPRKEILAGELSPELLAAKLRLVVEGKAPQLYQDPTAFFANIFATDGLKTLISEVFGQLLKEAVGSPITRLQTSFGGG… |
| A0A5C2MBE1 | 4-98 | GLPSLFQVCTPRADVRQGQIVDSDFAADLAQVIRGQAPPAYQDPQQFFAHTHPTRGLRLLTSVCQRLQGSHEQVGAIFRLDTSYGGG… |
| A0A2C6MFQ1 | 1-98 | None |
| G8N7R1 | 174-275 | None |
| A0A2M8NYV1 | 171-266 | None |
| A0A7C1KIC0 | 162-257 | None |
| A0A0N9UFQ7 | 167-271 | None |
| T1BN46 | 7-110 | None |
| B9L4L1 | 1-80 | None |
| A0A3B8Q2F3 | 164-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.