DPCstruct | MC11553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 46 ± 3 aa |
| Standard deviation of domain lengths | 2.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 65.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674NS11 | 83-128 | DASIVAQKWWCQMQPCMEGEECKVLPDLTGWSCSTGNKVKTTKVTR |
| A0A5J5N2H5 | 24-67 | RIIRTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS |
| L9JEN8 | 92-135 | None |
| A0A4U5UQ07 | 201-245 | None |
| G3IDS6 | 81-124 | None |
| A0A556UG53 | 397-441 | None |
| A0A6J3GUW2 | 81-123 | None |
| A0A6I9JZB8 | 88-132 | None |
| A0A674KCA0 | 76-122 | None |
| A0A4W4DWN6 | 81-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.