DPCstruct | MC11552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0V9D5 | 1-69 | MVHIGQLIHQELLRQERTPAWLARKINCQRPNIYYIFSQPSINTELLERISRALGVDFFMVLSECIKKE |
| A0A412Y932 | 1-69 | MINIGKLIEMELHRQERSASWFAKKLYCDRTNVYSIFKRHSIDTDLLMRICYILNCDFFRYYSGELQEH |
| A0A255SRF6 | 33-99 | None |
| A5ZEX5 | 40-108 | None |
| A0A5N7V1A2 | 16-93 | None |
| A0A1M6U4Q0 | 3-70 | None |
| A0A354I114 | 2-68 | None |
| A0A358PJN4 | 4-70 | None |
| A0A7V9RT82 | 16-100 | None |
| A0A4S4GGM3 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.