DPCstruct | MC11550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 367 ± 36 aa |
| Standard deviation of domain lengths | 36.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7UJV3 | 1-311 | MDDAIEDEAVVLEDQTAVLPTMTSNRPIDYQNMIPGDQWRLWVPFHFLPGNDETAQAFVEKMVCTKHSIPARKMLEHAVQNKLETFG… |
| A0A1T2KZE8 | 30-436 | YDYHYHATMFAALTAGFEYDDAVEIASASLFVDYCDYSNFSYNFNIEGENVGRPILTSQYNNVSEWVDKSDPSIWALFHFLPGNFKV… |
| A0A7Y4N2C9 | 22-411 | None |
| H5XVF3 | 1-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.