DPCstruct | MC1155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Standard deviation of domain lengths | 15.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8RBS4 | 1-103 | MWIFTKHGFLAIVQHNSMSDFYQVKSRVIDPLEKLWPDIEIEIIHWADYRFRITIPKKQAISVIAEQMQSIDYTSYKNECETDDWFY… |
| A0A6I2YAE4 | 1-107 | MWTLTTRGFYSVVAHRELPDTVLVRGRVRADLDALGDLIPGLTVYEDRGADYRYRAVVSSPAWRAALDAMASEIDYDNFKNAVAERQ… |
| A0A2Z6E1I7 | 3-85 | None |
| A0A6I1K1I5 | 1-121 | None |
| A0A6P1JAF6 | 1-89 | None |
| A0A3M1Z2E7 | 1-122 | None |
| A0A7X8C9U8 | 1-85 | None |
| A0A1N6LHV7 | 1-110 | None |
| A0A6S5C7I9 | 1-119 | None |
| A0A1V5DP21 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.