DPCstruct | MC11542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 202 ± 31 aa |
| Standard deviation of domain lengths | 30.54 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9HV15 | 6-221 | ENFSNWFLQNRFELLTQARKWKKDNIQLEKEFLIEWPLERIKIMELDEYIIGKGPENKSLCYELEFGKYRGLYLSIKGGSSAKFGIY… |
| A0A0N8UHF4 | 15-197 | KVRGEVASDFKSINDLRKKFTLDYSINKLLTLKKEEYAVGLGESTFCNRIENELNEWGNIHGSPATKFGIYFGKFGEDKSRKYRVGR… |
| A0A1H7V8S3 | 7-273 | None |
| B1I203 | 5-244 | None |
| A0A2Z6G878 | 1-198 | None |
| A0A0E2G988 | 2-152 | None |
| A0A4M9XV82 | 9-252 | None |
| A0A2Z6IA76 | 44-238 | None |
| A0A0F9NER7 | 67-280 | None |
| A0A497NZG5 | 4-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.