DPCstruct | MC11541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 66.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZM16 | 2-64 | DKDADGHITEAEVKEIIMLSASANKLARLKEQAEEYAALIMEELDPEGLGYIELWQLETLLLQ |
| A0A6A1WF56 | 35-104 | VYKVDKDADGRITKLEITEIICLSASANHLSNIQKQAEEYAALIMEELDPDNFGYIMVNNLQHDLMVKLG |
| A0A446J935 | 54-158 | None |
| A0A7J7MU69 | 101-171 | None |
| A0A835PUQ2 | 11-83 | None |
| A0A287G5A5 | 271-332 | None |
| A0A804PUZ9 | 1-74 | None |
| A0A445DUR1 | 1-71 | None |
| A0A445A0I4 | 181-242 | None |
| A0A7J7CA28 | 243-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.