DPCstruct | MC11540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3JQC5 | 3-66 | AGEIARALGLRRVGTAWRGACPICGGRNRFQIREGRSGPLIWCWGGCKPADLLVELRRRGLWPE |
| A0A317TKJ6 | 3-82 | FEEITDKFEIDKHSRKSDRVQAKCPCHDDENASLTISHKGDKTFLFCHAGCETRDILESVGLKMSDLFDKPLEINEEKKV |
| A0A2V9BUN0 | 2-79 | None |
| A0A2H6HS35 | 7-89 | None |
| A0A386ZSS6 | 140-232 | None |
| A0A1I4WPC9 | 29-118 | None |
| A0A7I9X5Z1 | 5-71 | None |
| A0A1X1ZEZ6 | 11-107 | None |
| A0A522DQ94 | 3-81 | None |
| A0A7C6D6Y9 | 3-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.