DPCstruct | MC1154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 219 ± 26 aa |
| Standard deviation of domain lengths | 26.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3BSE3 | 7-225 | TGGDGPAFQPEDRAAFAEVVDEVLRSEPLRRGLRTAPEGTAALLRDWALASAEDVARPAAAEYRELCRVRAGGGVAGAAPGSRTPGG… |
| A0A7M2SY39 | 37-236 | SRHPAKPHLLAEDRHDFERTLDEVLAAEPSDRPARLDAEQLRTMALTASQLIAATAASEYTQYVEMRERARNPRGAEAPLTDSASAK… |
| A0A1H9CHN3 | 1-239 | None |
| A0A1C6MTJ2 | 9-295 | None |
| A0A1C4JUP6 | 1-190 | None |
| A0A327UGZ9 | 1-227 | None |
| A0A3N4S3K7 | 2-186 | None |
| A0A4Y3VSH0 | 93-330 | None |
| A0A3D9NR21 | 4-216 | None |
| A0A6G3C719 | 1-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.