DPCstruct | MC11538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 185 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3NYH5 | 85-289 | MLVAVATHAALMKSGRNAQKEKIQAAADKVLDPYLAVLADFNYRELMQSGLSFTTAGAAKQLVEAGKKHDDIWLVLSTAVFSMTQDQ… |
| A0A1I5WBC0 | 17-232 | LIGALIDSSVQQSRQKEMSAEIGAIVGPLLDYDYRVEAGLAIGEMLNTPSAFPMKIASSQVLAGMPAKAEQAARIAATKTGPAYLVL… |
| A0A6M4A5D8 | 27-204 | None |
| A0A1H7MIK8 | 90-311 | None |
| A0A1G0IBX2 | 118-292 | None |
| A0A7W9K0G9 | 57-276 | None |
| A0A344J4U2 | 4-192 | None |
| A0A345Y5P5 | 2-135 | None |
| A0A1J1EB36 | 82-261 | None |
| A0A2T5P9T6 | 2-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.