DPCstruct | MC11536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9Q3V8 | 2-133 | HFWIGTTALDEAQFGAYFDNAANYSELDVEDIEAADHDVTGCGFCQDLGQKFLYDEDLLLVIWLEEPVPVEQIVAMSALRSEDSAQA… |
| A0A1I5NSE2 | 17-128 | FRSPGEVSIWLGYSQDVDQSIDVLQDLCGVGYYSLDEQEANCFSFELTKVERLLEEISCAASFAAAAVRAAENRKLSEARWITVQFD… |
| A0A225CJX1 | 184-298 | None |
| C3GTI7 | 5-100 | None |
| A0A0H3HZB2 | 8-116 | None |
| A0A3D2ES32 | 7-130 | None |
| I3TRW5 | 3-107 | None |
| A0A2M9C4F0 | 49-186 | None |
| A0A4R2H452 | 2-138 | None |
| A0A4R4DQZ4 | 64-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.