DPCstruct | MC11534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 234 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417CXC8 | 126-332 | TPDGYIAVISQRHENAEQNVREVFDHFAGKLMIQDSEYPPDQTAHYSPGNYIGHSRGVYYNAASDMTNPRGAGTTYFHELAHMIDHA… |
| A0A416RXU8 | 7-240 | AFISKLPQRRRSIVHTAYANAPDYIVAAINQHFDQLNYVRDTKYQQDQFGNYILNEYGMRSKEPCHYSQEKKYIAMHDEMTDAEYAD… |
| A0A1H7LVA7 | 436-654 | None |
| A0A2D9CIE9 | 372-615 | None |
| S4EX57 | 131-358 | None |
| A0A2A2X703 | 254-481 | None |
| U2VAG3 | 388-621 | None |
| A0A1Q6PTQ4 | 1-265 | None |
| R6TYJ5 | 163-386 | None |
| A0A373MJD6 | 83-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.