DPCstruct | MC1153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 189 ± 30 aa |
| Standard deviation of domain lengths | 29.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 17.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0V1Y0 | 6-161 | QVRWGIPASEAGPSGLGFTGVGATPITLGSIFQLGALRHFNNPIYDAANSVGLSVTLDFAEIADEIFNFTMNIDETTNSGTCSYFSV… |
| A0A345QSU3 | 3-174 | SGSATGENTDVLAWNGFSNPGSNYTLNAASGGSNLSSPFDLGEFVHNNFVINLNNGSLLSADLAISIAGSVNGTAFSIDPTFSFTHI… |
| M1P4B5 | 99-267 | None |
| A0A7Y4TH03 | 1-266 | None |
| A0A7V9TYU9 | 35-207 | None |
| A0A7V9CA76 | 1-210 | None |
| A0A480AJ19 | 30-228 | None |
| A0A848X080 | 402-591 | None |
| A0A2N1RLI2 | 31-227 | None |
| A0A2E0R3A5 | 395-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.