DPCstruct | MC11526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 185 ± 26 aa |
| Standard deviation of domain lengths | 26.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644Z685 | 1-140 | MQGVSAVKAIAIAQSQGQKIYTINPSNRDTALPKLSLGGDVGAEIRNAIEAGKEVTFHENQINAYGWHGLGYVITDSDTGAGAYLIN… |
| A0A380N0V4 | 2-175 | QVASQKGQIIYHITKDNYSQILPQLKLSSHVMSDIRDAISAGREVTAHERNISVKGWTGLGYVILVPTTGAGAYLIDGGANGGLAFA… |
| A0A7H4GQ42 | 114-306 | None |
| A4XG91 | 766-962 | None |
| G8LY28 | 266-461 | None |
| G8LWN6 | 764-945 | None |
| A0A6N7EYA3 | 2-202 | None |
| A0A4Q3ZJJ6 | 96-225 | None |
| A0A2S5CFK7 | 470-667 | None |
| A0A1B8PMK1 | 17-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.