DPCstruct | MC11525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 63.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E2Z113 | 1-85 | MYLTDYRERTLKDVITQLEPGLFKKVTGLTQPDFQLLVSPRIFNSALMNDAVYKLKRYEDASLSYTGINPHEGEDVGLYDTVLSE |
| A0A380MY71 | 1-86 | MYLSDYREHSLKDVIQELEPDLFTKVTGLSQADFSLLVSLNVFDEAVMNDAVYKFKRYEDASLEYAGIDKKEGYIGLYNTVIIKKP |
| A0A5E5Q175 | 111-195 | None |
| A0A564S253 | 1-86 | None |
| A0A4S2F2L3 | 764-852 | None |
| A0A1M4WE03 | 777-865 | None |
| A0A645BBT1 | 255-347 | None |
| A0A4Y1Z8Y4 | 1-98 | None |
| A0A7V4IYB5 | 32-118 | None |
| A0A1C5QPF2 | 124-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.