DPCstruct | MC1152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352CAR8 | 7-118 | LHALTKRLIERIHQMSMERRIAWSADDLGSQCSFAADGFSVELLQGQAGPSVHIRNADGVIIERATPTDLGEERNAEGVSYHAMVAD… |
| A0A345QRV9 | 8-124 | TTLNKWRSLTKLLESLTKKGKLKWRETSNDDEFLTSHAGIVVVLRQTTSVDTPEDLYVVSLRNKQGKVIDVFDDELLDRDQTETNYF… |
| A0A2G2LSV6 | 3-118 | None |
| A0A2N0M9V9 | 23-129 | None |
| A0A543IVK3 | 9-138 | None |
| A0A1F2VEX6 | 1-108 | None |
| A0A2E4QNN3 | 1-117 | None |
| A0A439F3U1 | 2-116 | None |
| A0A1F3K6R2 | 2-108 | None |
| A0A3A4PXL9 | 3-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.