DPCstruct | MC11518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 233 ± 43 aa |
| Standard deviation of domain lengths | 42.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 89.47 |
| Assigned Pfam label(s) | PF20155- PF06791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3TV75 | 16-204 | KELATAADGYANLSARIQQTTKDSGDFNSAIAGVHQIALSTNSSLETTAELFTKLNTVSKDLGMSQQQALDLTKTVTQAIKLGGSSV… |
| A0A212IWK0 | 10-272 | ISAIDKASQVFRALGRTADDLKKKLSVMTGALTLGVGVGSVIHAVDALTDSMLSLSRLKISYESIFGSEYAASRQLDFVYRQTQQIG… |
| A0A142X1H9 | 72-309 | None |
| A0A1M3Q4W7 | 13-245 | None |
| A0A418M683 | 391-605 | None |
| A0A7D5MY04 | 3-263 | None |
| A0A2M9WNW7 | 2-239 | None |
| A0A6N3R6U8 | 2-187 | None |
| A0A377YN61 | 3-205 | None |
| G2FD77 | 53-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.