DPCstruct | MC11516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 175 |
|---|---|
| Mean domain length (aa) | 185 ± 37 aa |
| Standard deviation of domain lengths | 37.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 99.29 |
| Assigned Pfam label(s) | PF10510- PF02622 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3R623 | 3-127 | LLVECNEEGAVGLVINKVFDRSLNALAEFSQSPALPLYAGGPVDTEHLFFIHRRPDLVPDSQAVTRDICYGGNFKKAIDYINRQMLM… |
| A0A1G0F8G5 | 23-201 | LFQPTVLLAVPTQPIPLAKGVLLIASEQLKDSRFSKSVVLLIHYGPEAASGLVINHPTDLELSKVMPQAGAIRPEINTVYWGGPVDS… |
| A0A835XMG5 | 17-193 | None |
| A0A6P5WAZ3 | 2-136 | None |
| A0A5P1F1U5 | 18-158 | None |
| A0A0V0QHG5 | 286-424 | None |
| A0A377BZG2 | 1-117 | None |
| A0A2E8WNP6 | 7-163 | None |
| A0A7S4S5J9 | 136-354 | None |
| A0A7S4UCU6 | 109-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.