DPCstruct | MC11515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 165 ± 15 aa |
| Standard deviation of domain lengths | 15.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 57.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453F2N8 | 96-251 | FSRMFVDALDAQMYDKHHQTGHCILSLHRDKHCYSGVLELIVNVWAFHSARRMVYVNPETGAMQEQHPLEGRRGQMSIQWFSYATLK… |
| A0A392NQL1 | 2-153 | FVDALDAQMYEEHHSTGHCPLSLSKDKQCYSRVLELLVNVWAYHSARRMVFVNPETGLMQEQHNFKNRRGQMRINWFSYNTLKNMDE… |
| A0A5N5HPC4 | 482-669 | None |
| A0A7J7N4Q8 | 578-747 | None |
| A0A6M2F4R5 | 864-1019 | None |
| A0A843UEA9 | 224-416 | None |
| A0A1D6FZK9 | 593-748 | None |
| A0A6V7PWR2 | 6-159 | None |
| A0A3L6DB07 | 137-330 | None |
| A0A452YT28 | 2-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.