DPCstruct | MC11514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Standard deviation of domain lengths | 19.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453STL6 | 1-85 | QVSNSLWENPHAAATSWKPCAERRRDEISDLVPENETSGYIFIHAEGGLNQQRIAICNAVAIAKIMNATLILPVLKQDQIWKDQT |
| A0A392N734 | 3-93 | ALAAHALAENKREPKDLWQEPLVPASSWTPCSDQRSWEPNEGSNGYIMITANGGINQQRVAVCNAVVVARLLNSTLVIPKFMYSSVW… |
| A0A822Y686 | 11-118 | None |
| A0A7J7MRZ8 | 1-138 | None |
| A0A397Y9G3 | 56-150 | None |
| A0A438C310 | 107-203 | None |
| U7E0K3 | 1-76 | None |
| A0A4S8K769 | 4-117 | None |
| A0A835M3Q1 | 21-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.