DPCstruct | MC11513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q3SC80 | 1-84 | MEESVLQHLENLMSQLTEETRICFRDSLYRLAGNSKHGACQSRNAMPDQDSTRFNEEETTESRTNVIDRTVANFLFSNVEFGAS |
| A0A392N1I0 | 1-113 | MDLSEQFSGDEAMHNHSSIEESTLQNLEAIISQFTDKTRISFRDALYRLARDTKQQLVVEDLDGDVSMQEPMSWGVHNESLRSEDEQ… |
| I3SFZ3 | 1-101 | None |
| A0A5B6YKV2 | 1-104 | None |
| A0A5B6YK64 | 157-268 | None |
| A0A1U8J7C0 | 60-174 | None |
| A0A2K2B9K7 | 100-207 | None |
| A0A7J9AB59 | 7-125 | None |
| A0A833SJC2 | 216-328 | None |
| A0A5D2ZDU6 | 143-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.