DPCstruct | MC11512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 374 ± 25 aa |
| Standard deviation of domain lengths | 25.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821QV49 | 1-378 | PIMIDLNTWLQWLYFFQPRYGSLKTFIARKQTELDGLLLLETSTHELFRLPIESSLTHFEQELAKMNVRLAVGYLCTSIIFEHIHVN… |
| A0A392N0X5 | 1-371 | MLSDLSKWSHWDLMFAPSLGSLISWLLNDVNTEELLCLVTRDGKVIRIDHSATLKSFLEAAVQGSSFRTAVNLLSLISLFGGKRKVP… |
| A0A060WMP1 | 137-545 | None |
| F6GWI7 | 261-671 | None |
| A0A818CDR8 | 36-393 | None |
| A0A821SR82 | 585-943 | None |
| A0A1S3KG26 | 181-585 | None |
| A0A815EEQ8 | 741-1090 | None |
| A0A1U8G463 | 144-508 | None |
| A0A815U430 | 7-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.