DPCstruct | MC11510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1UEH2 | 1-158 | MNKNPLLLPTFTLAALLFTASPAPAADQAEMVRIPHEVREIEGWTVQVDTSLLEGKHKPSGDLALKVLEQRLHRIVMRLPEEPVARM… |
| A0A7C4LLV0 | 29-150 | AYHQTELLGHTIYLHPELEQHPAELAAALDELARQLRNIQQVVPAGPLAELRKTPFWVEWERRPRGACEVHVSAEWLRANGYNPDKL… |
| A0A5C6ANG8 | 605-749 | None |
| A0A6L7VX99 | 1-167 | None |
| A0A3L7UXN4 | 1-152 | None |
| A0A2E0R418 | 3-131 | None |
| F0SF92 | 63-235 | None |
| A0A6N4T850 | 1-179 | None |
| A0A177QPA5 | 1-161 | None |
| A0A6U2PH21 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.