DPCstruct | MC1151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 201 ± 25 aa |
| Standard deviation of domain lengths | 24.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8MFN1 | 10-152 | WALWFFWIMATTLGWFLGGLISSPLTIVISGFLVGIFQWLVLQGRIARPWRWIFSSFCGWTIGYFITFYGALWEFEIFDGAIIGLIV… |
| A0A345QIG5 | 4-210 | QPNFTKQLETRMGLWVSWTLVTAICMYIGNVGAFNTVLAWGVPALLGALQWILLRRWVSRPWQWILVTYLSLTIGTMVGAVGGGIIQ… |
| A0A370GHQ3 | 39-270 | None |
| Q113M2 | 611-830 | None |
| A0A2W4X7N9 | 11-227 | None |
| A0A2A9ESL3 | 3-239 | None |
| A0A3A8G5P4 | 293-501 | None |
| A0A841VL68 | 2-163 | None |
| A0A7C9NLZ5 | 130-324 | None |
| A0A0P7ZPN7 | 26-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.