DPCstruct | MC11509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 52 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3ZAK8 | 1-55 | PDCLELTAALEDGTVMGIRHRNHPIEGVQFHPESIRSEHGHAMLQNFLKSVPEPA |
| X8CN26 | 2-47 | LEVTARTRSGVIMGVQHAELPIHGVQFHPESILTEGGHRMLANWLA |
| A0A7Y2CCB5 | 19-83 | None |
| A0A7C4WBG1 | 31-80 | None |
| A0A831Z788 | 6-56 | None |
| A0A449G6R7 | 30-86 | None |
| Q0FAN3 | 116-164 | None |
| A0A7X7B081 | 73-126 | None |
| A0A6D0F2I7 | 1-45 | None |
| A0A485AF49 | 1-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.