DPCstruct | MC11507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1SUP5 | 134-217 | QGVLAVRFHLAPGIKVRPTLGENIARLVLPNGSVWSFLWEGARFHDEDSVRQSAYLGFHRTRQLVLEADVVEGGEIAWIFTKDQ |
| A0A258RZP3 | 170-259 | AFAIRFHLHPSVTVERLADPSTVLLALPGGEAWAFLAPNQSVLLEESIYLAAPDGPRRTVQLVISGSLAETGRVLWTLVRTRERQPP… |
| A0A519PMP1 | 1-84 | None |
| A0A418WHH9 | 268-353 | None |
| A0A1G0GZ54 | 3-82 | None |
| A0A257YS78 | 1-85 | None |
| A0A840I0K2 | 419-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.