DPCstruct | MC11505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6LP71 | 2-105 | SGVAQMSTAVIASVDHGPVVTVRRVLMDRDTYAVRWGYGPRASEKKRMVLGGLLDSKGRPNENTPKEWLRAEGFLPKMTGEGGGQNT… |
| A0A0M3KJZ9 | 1-91 | MTTATMAITDHGVVAKIKRVIMERDTYSRKWGLGPVASKKKSMIQQGLLDKYGKANEKTPKNWRSAYYEVSAPARAENGEEPMQTED… |
| A0A2D4KF38 | 138-252 | None |
| A0A7S4PFQ1 | 6-104 | None |
| A0A086JG82 | 1-103 | None |
| A0A3Q7U9K2 | 236-350 | None |
| A0A505ICT2 | 327-428 | None |
| A0A5N5JJJ3 | 508-622 | None |
| A0A401KZK8 | 556-665 | None |
| A0A1A8WN37 | 93-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.