DPCstruct | MC11503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T8H1B1 | 715-815 | LKVSKKAGKQHEDLLSAGGDKAQGGIGSSSDSSDEEEDKLNIFCLASGHLYERLLKIMMLSTIRNTKAKVKFWILKGYLSPSLKDFL… |
| A0A482WZN0 | 261-356 | KPDKIGMDLLGEDDDSQPGLWNSITSTFGSSKEEQVEAETINIFSVASGHLYERFLRIMMLSVLKNTKSPVKFWFLKNYLSPTFKDF… |
| A0A2D0RWP3 | 1-111 | None |
| A0A7J5Y7N8 | 132-232 | None |
| A0A507CZN2 | 233-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.