DPCstruct | MC11502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 96 ± 19 aa |
| Standard deviation of domain lengths | 18.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4Y270 | 42-181 | LGKEKLEKKLNEKISDEMYAHLLMAFDFLVGLPSSSVEEKFIMQYREPMAASTKSKLFGPVIPEVTVCPTTHRRLASVRTHCKDTTV… |
| A0A0M3KIH2 | 24-115 | MAFDYLCSLAFSSMERDFIFEYRMPIASGAGSRLFGPEIPQVEVIPETNRRIARSETTVKTTKALVTVSDAGTGKYTVNGHGIDEFR… |
| J9ESE8 | 2-85 | None |
| A0A132A9R0 | 280-363 | None |
| A0A7R9QQW6 | 142-221 | None |
| A0A7R9MHQ5 | 2-73 | None |
| A0A0D8XUZ4 | 479-592 | None |
| A0A183NKC5 | 25-105 | None |
| A0A0B1S9J7 | 2-92 | None |
| A0A1S3DKL3 | 66-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.