DPCstruct | MC11501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 216 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3KHZ1 | 1-250 | MVVKRRESLSSISGVTLALTRLHTRTPSNSAIHRLCFWIVILLFQLEHATIYEYAVQLLHSNLIHLDQMGVFEHTSLERVAMDARLH… |
| A0A1B0DLA3 | 187-366 | VKQLLRILPLLRPESPIHRALFWVAVSVLQLDEVTLYAAGLALLEQNLHTLNSQSLFDKQSLMDVMMATREPLEWHFKQLDHAVGLS… |
| A0A1I8HUJ6 | 82-273 | None |
| A0A6P8J3N3 | 89-303 | None |
| A0A2J7Q2G1 | 491-722 | None |
| B4DXP1 | 1-204 | None |
| A0A7R8H9X3 | 824-1051 | None |
| A0A183LQU1 | 382-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.