DPCstruct | MC11500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 164 ± 39 aa |
| Standard deviation of domain lengths | 39.31 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3J781 | 20-210 | TLVLCRARHGLMFCNKLGAACAKLTQSTFPSDLAMVGMDAKIPELVAKCMIEEPYVAIMMVEYGFTKMDSWMSTCKITVWNGPITVV… |
| A0A0M3KH50 | 7-167 | PIIICVSKYDIDFCKKLVVSCAEQAHLAVPEWSIRSSLPLPQPIATCIIKENYVAMCYAQDGVTLCNTWFTACFIVNFELPFTEKQK… |
| A0A0M3J425 | 145-292 | None |
| A0A183UE87 | 161-354 | None |
| A0A0B2VYF0 | 162-309 | None |
| A0A0M3JHG1 | 4-115 | None |
| A0A0M3JFB0 | 2-148 | None |
| A0A0M3JBZ4 | 14-155 | None |
| A0A0M3J335 | 46-175 | None |
| A0A0S3Q267 | 4-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.