DPCstruct | MC1150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0311 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8P9D0 | 7-107 | AIDNGEVPDRETLKAAVRALLEVLAERAPGHTVEVRVPLYGAVQCVEGPRHRRGTPPNVIECAPLVFLELAVGRRSFADAAATGRLA… |
| A0A3G6J475 | 74-194 | IDPQQLREAVMAILPWIADPATQPEPTRPQLAAACRMLARTAAQDAPGKTVELRVPPFVAVQLIDGPAHTRGTPPNVVQLDPLTFCR… |
| A0A2H1IFV4 | 377-491 | None |
| A0A543MAN7 | 12-119 | None |
| A0A3P1T2G3 | 6-102 | None |
| A0A7L7M9T9 | 219-319 | None |
| A0A269T888 | 57-176 | None |
| A0A1H2LB11 | 3-98 | None |
| A0A7X7XNN0 | 66-185 | None |
| S3WXE6 | 162-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.