DPCstruct | MC115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 225 ± 21 aa |
| Standard deviation of domain lengths | 20.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6RER1 | 3-230 | RIRTDAVAVSAVAIVFLVVAVIGFTPRYFGPLFAGGYQSPSAWMHVHVISSLLWLMVFLVQPLLILRKNFDRHRLVGRAGLLIAVMT… |
| A0A2M7GW56 | 12-230 | PFFLAMMLVLAALVVAGFGPSFYFPDADRSVLSPALKIHGVIFSLWMLLLTTQASLIPAGRYGLHKVMGLMSLPLAAAMIVFGFLAI… |
| A0A0H0XQT9 | 2-201 | None |
| A0A7K0F2F4 | 2-191 | None |
| A0A1M5UE05 | 10-231 | None |
| A0A7Y0BQ82 | 1-244 | None |
| A0A2T5GJ55 | 1-207 | None |
| A0A844ZQX2 | 1-243 | None |
| A0A1X7KG99 | 7-206 | None |
| A0A7S8F2Y6 | 7-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.