DPCstruct | MC11498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 277 ± 49 aa |
| Standard deviation of domain lengths | 48.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.47 |
| Pfam Score | 48.27 |
| Assigned Pfam label(s) | CL0123- PF09724- CL0662- PF12572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3KGQ7 | 19-316 | LFKGEVQQIEFSEPLLSGDYRLLQVDPELADQIEKGSSLTFRGELDDYPVLCTKDTTYCVKEAETSNTLLVLPQLDFTNDKSDENER… |
| A0A6G0TDT2 | 35-347 | QPIYFGEKFENYKLLQLDEHILSDLKCGQTVVFKGDHNESAVLCTKAKTYDVKEAETSNSILLLPELTFPDEDTNNTELTNRKVVGI… |
| A0A5C6T212 | 17-370 | None |
| A0A0V0QIQ8 | 4-267 | None |
| A0A1V6PAD5 | 1-356 | None |
| A0A1X2IJA9 | 32-283 | None |
| A0A7R9L1R1 | 3-223 | None |
| A0A1J8Q981 | 225-525 | None |
| A0A1W0E5I3 | 3-279 | None |
| E5A2V8 | 229-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.