DPCstruct | MC11497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 89 ± 2 aa |
| Standard deviation of domain lengths | 2.44 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183D321 | 80-169 | SADKALLFMTTCGPRGPTVGQMWDCASSRKDHSKCCRMVGVGPECMAYCQTTNGVPSDPAIYMNCLKYFDAVKLCFKQYLSKNPNLY… |
| A0A0M3KEN1 | 1-87 | QAGIYVALCGPRYPTVSNIWDCQSSRRDHTRCCMAKGVSETCLTYCDATYGLGVEPAQINNCLNYLNPIRECFWEYLEENPNMYGDL |
| A0A811KBR4 | 51-138 | None |
| A0A0N4Y9U9 | 142-236 | None |
| A0A2A2L8R8 | 257-345 | None |
| A0A6G0UUQ1 | 400-488 | None |
| A0A183HVR1 | 144-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.