DPCstruct | MC11495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 147 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3KD46 | 28-173 | ERIRLQNALMDSSHSCTQINLRNTLNVQLSREQSKQLFIVNTLPFIGFGFLDNFLMIVAAEYIEHSLGMVLAVSTMAAAGLGHIVAD… |
| A0A7S2PQA7 | 1-122 | PTRQQLKAHFVQSMVPMVGFGFMDNTVMIYAGSAIDATLGVTLGLSTMCAAACGQICSDIAGVSFGGVIEATAAKLGLPSPGFTEEE… |
| A0A679KWC9 | 322-458 | None |
| A0A2A9MCX9 | 249-390 | None |
| A0A418AMT3 | 392-529 | None |
| T1PI43 | 6-141 | None |
| U6LPJ9 | 263-401 | None |
| A0A2A2KPI4 | 378-533 | None |
| D0N4Q8 | 45-202 | None |
| A0A061IVC9 | 165-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.