DPCstruct | MC11494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 66.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3J1X8 | 1-121 | MRRKGDNWNANDLFRFQYGCFDGVEADELREICEEWLNRLYAIPKKYCYLAWYASAIYACFYRIAPLITDIDDKKDLWQDVKREYAE… |
| A0A0M3KBY7 | 1-141 | MRRKVIFASVVFFFKYFPFKGDNWNANDLFRFQYGCFDGVEADELREICEEWLNRLYAIPKKYCYLAWYASAIYACFYRIAPLITDI… |
| A0A183DQH6 | 1-130 | None |
| A0A0N5ATI2 | 53-200 | None |
| A0A183HFI2 | 1-122 | None |
| A0A0N4TB94 | 1-128 | None |
| A0A1I7TPU3 | 10-155 | None |
| A0A1I8ESD9 | 71-215 | None |
| A0A2A2JIJ3 | 141-267 | None |
| A0A0N4X6D9 | 75-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.