DPCstruct | MC11493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 302 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q22493 | 66-385 | QKLLDILVKVTFIERNLCLNGPQSGESLFESLEEARSDEQPLLFATVSDLTSFCDSMKPIFQTEKVKGTLIYRNSGYQSRRFIQYIR… |
| A0A2G5SX93 | 80-376 | EKLLNDLIRITFVETNLVLNGRQNAEQLFANLLLAINEEQEIPFKSAQELANFCDSMPLNFRKDAQLYRNTGVQGRRLIQELKRKLT… |
| A0A0N5AFH3 | 5-332 | None |
| G0NKX4 | 92-399 | None |
| A0A2G5SNG2 | 72-349 | None |
| A0A2G5SNP2 | 174-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.