DPCstruct | MC11492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5NVB6 | 129-285 | VFVSNTVNQMTDLPFGAIGSGAAVTSQCPCQNGQYYYFNPVTETDWNNIIGNNEQAFQLSCSTGTMTCICTSPTMCYMPSAGTETFV… |
| A0A0M3K7K2 | 5-171 | TADVTQSDTEFGYNNSTPGQSPQSVVLSTVPGECHCKSGATEYYYKGSHDTNWLDYLDGSQPLVMTLTCGSRGVNGSKDMCVCVSDN… |
| A0A811L7T1 | 49-194 | None |
| A0A4U5NUE9 | 21-154 | None |
| A0A1I7YW42 | 23-192 | None |
| A0A1I7YTS6 | 2-129 | None |
| A0A1I7YND5 | 293-451 | None |
| A0A1I7Y7S6 | 1-112 | None |
| A0A6V7WB45 | 139-298 | None |
| A0A0K0EJR5 | 87-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.