DPCstruct | MC11490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 233 ± 30 aa |
| Standard deviation of domain lengths | 29.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 58.89 |
| Assigned Pfam label(s) | PF16057- CL0266- PF06469 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7HAQ5 | 1-222 | MEQYELDTFGRSHDIMSNFWNSCFDDLMSTAYKREKDRADSKSKFQEVIIDPCMKRVRSESNRYVIWQKQNASQQGVVWQHWRALRR… |
| A0A0M3JYY6 | 2-240 | AHATRDHVLRVANEADFILNRLRAEDVTKHAQFEGDAAEQMHKRRREETINEHLITASRRRDQLIATRLIDKITTILTSTSGAWADN… |
| K7H7M1 | 642-817 | None |
| A0A1X7SSK5 | 3-200 | None |
| A0A1I8IGR4 | 290-556 | None |
| A0A0K0EAS9 | 1555-1789 | None |
| A0A6V7U057 | 43-298 | None |
| A0A815EDS9 | 274-493 | None |
| A0A183HP38 | 1-204 | None |
| A0A1S3QCN1 | 575-817 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.