DPCstruct | MC1149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Standard deviation of domain lengths | 14.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06781 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087ATG2 | 117-218 | MGKIQDVLNATLDSKDMSPQMRRLMQRQADNTKRVQESIKGTKANPSWYVPLFCVLMVIGLVWAVVFYLTGNQYPIPGIGFWNLLIA… |
| A0A6I5ZVQ0 | 5-114 | AHACDPDGCPGRTDGGRRPRSQTGAHRRARVEVAQEGVVHASPGKASTPAPLPRWFLPLALGLMILGLVWLVTTYLSPGARYPVPGI… |
| A0A5J5DW22 | 11-140 | None |
| A0A848JCL8 | 105-224 | None |
| A0A849PJA2 | 3-132 | None |
| A0A261FC05 | 40-159 | None |
| A0A7T3CHH3 | 16-130 | None |
| I4LWD8 | 16-133 | None |
| A0A2N6UNL0 | 1-85 | None |
| S4H3L6 | 33-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.