DPCstruct | MC11489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 237 ± 25 aa |
| Standard deviation of domain lengths | 25.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JWW7 | 1-238 | LGLCALLSTQKCVLLELNEHYETFVERKEQCIRSLNAVKATMKLVMIGGSTSSVSNTQYLELCKSVHKLFFQLLLMSDKLNEMIKGI… |
| A0A1B6FWW5 | 79-312 | DTLALHGDPPLVWFSPERVAGPRLAESLRFGMLELKEHLDTFLDRKDHAAECMDSLKAVGNKESVLDVGRSLYKLHFQLLLLLESAN… |
| A0A1D2N0V0 | 662-880 | None |
| A0A3P9CZE3 | 149-357 | None |
| G3PM82 | 42-278 | None |
| A0A6J2UBK2 | 6-221 | None |
| A0A437CME5 | 546-824 | None |
| A0A286XS89 | 743-1016 | None |
| K1S1L9 | 8-247 | None |
| A0A834ELM0 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.